PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 416aa    MW: 47436.8 Da    PI: 8.5424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06258.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-18103149148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +l+++vkq+G + W++Ia+++  gR +kqc++rw+++l
       KHN06258.1 103 KGQWTDEEDRKLLKLVKQHGVRKWSLIAEKLD-GRAGKQCRERWHNHL 149
                      799*****************************.*************97 PP

2Myb_DNA-binding50.83.8e-16155197145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+ +lv+ +++ G++ W+ Ia+ ++ gRt++ +k++w+
       KHN06258.1 155 KDSWSEEEERILVETHAKIGNR-WAEIAKFIP-GRTENAIKNHWN 197
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.30498153IPR017930Myb domain
SuperFamilySSF466898.63E-31100196IPR009057Homeodomain-like
SMARTSM007176.9E-17102151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-28104156IPR009057Homeodomain-like
CDDcd001672.93E-15106149No hitNo description
PfamPF139212.5E-20106163No hitNo description
PROSITE profilePS5129420.063154204IPR017930Myb domain
SMARTSM007174.0E-15154202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-20157202IPR009057Homeodomain-like
CDDcd001673.63E-11157200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MCSVGPPFTA IERFLWGQQQ QTQYNVANNG HASIFGGSTY KFMWPNNSST TQEVSYAEQI  60
IFANNNEEAL NWTQQVCFKE DGKNIAKVVG RRPKKGSSVP LIKGQWTDEE DRKLLKLVKQ  120
HGVRKWSLIA EKLDGRAGKQ CRERWHNHLR PDIKKDSWSE EEERILVETH AKIGNRWAEI  180
AKFIPGRTEN AIKNHWNATK RRQNSRRKNK RAGTSNGKPQ PSILQDYIKS LTLITSTTTS  240
PVEQQIAPQL SNSVTNNENS SLMAESYDDE LLFMQQLFKE NNANNVESLK HSKNIINNSS  300
AASLDCYYHQ TNYNGGGQLL TDVTQCGFVV HSNPNTTNSH HNNMCLDESL FISRKSTTPH  360
APINYLDSDH VYLSHLLNGT AGSSFCYNNY GVHNQNNMEL QLGNQDCFEE RGRWIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-461012032104MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-461012032104C-Myb DNA-Binding Domain
1msf_C6e-461012032104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1199210KRRQNSRRKNKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003552966.10.0PREDICTED: transcription factor MYB35-like
TrEMBLA0A0B2PF890.0A0A0B2PF89_GLYSO; Transcription factor MYB98
STRINGGLYMA18G07360.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.11e-69myb domain protein 119
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]